Lineage for d1ppjn2 (1ppj N:234-442)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 515367Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily)
    core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta
  4. 515368Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (2 families) (S)
    Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues
  5. 515369Family d.185.1.1: MPP-like [63412] (4 proteins)
    Common fold elaborated with many additional structures; duplication: each family member consists of two similar domains of beta(2)-alpha(2)-beta(2)-alpha(5)-beta structure, but only the N-terminal domain of MPP beta chain binds the catalytic metal
  6. 515370Protein Cytochrome bc1 core subunit 1 [63408] (3 species)
  7. 515389Species Cow (Bos taurus) [TaxId:9913] [55997] (12 PDB entries)
  8. 515395Domain d1ppjn2: 1ppj N:234-442 [104268]
    Other proteins in same PDB: d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_

Details for d1ppjn2

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppjn2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjn2 d.185.1.1 (N:234-442) Cytochrome bc1 core subunit 1 {Cow (Bos taurus)}
crftgsqichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssp
lasiaatnklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatese
vlrgknllrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcsk
yfydqcpavagfgpieqlpdynrirsgmf

SCOP Domain Coordinates for d1ppjn2:

Click to download the PDB-style file with coordinates for d1ppjn2.
(The format of our PDB-style files is described here.)

Timeline for d1ppjn2: