Details for d1ppjt_

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (T:)

SCOP Domain Sequences for d1ppjt_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjt_ f.23.13.1 (T:) Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
wgtqefekskrknpaa

SCOP Domain Coordinates for d1ppjt_:

Click to download the PDB-style file with coordinates for d1ppjt_.
(The format of our PDB-style files is described here.)

Timeline for d1ppjt_: