Details for d1ppjq2

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppjq2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjq2 f.23.11.1 (Q:196-241) Cytochrome c1 subunit of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase), transmembrane anchor {Cow (Bos taurus)}
pehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrppk

SCOP Domain Coordinates for d1ppjq2:

Click to download the PDB-style file with coordinates for d1ppjq2.
(The format of our PDB-style files is described here.)

Timeline for d1ppjq2: