PDB entry 1ppj

View 1ppj on RCSB PDB site
Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
Deposited on 2003-06-16, released 2004-07-20
The last revision prior to the SCOP 1.69 freeze date was dated 2004-07-20, with a file datestamp of 2004-07-20.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.224
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ppjA (A:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjA (A:)
    atyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfveh
    lafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqncs
    ledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsrad
    lteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsqi
    chredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaatn
    klcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknll
    rnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcpa
    vagfgpieqlpdynrirsgmfw
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ppjB (B:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjB (B:)
    evpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassl
    ttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrw
    evaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyv
    qnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvha
    alvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnas
    ysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvess
    egfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpf
    idel
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ppjC (C:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjC (C:)
    nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
    ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
    wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
    vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
    nytpanplntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrs
    mmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtien
    kllkw
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjD (D:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjE (E:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1ppjF (F:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjF (F:)
    wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
    qqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1ppjG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjG (G:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpa
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1ppjH (H:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjH (H:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnslk
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ppjI (I:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlklsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjI (I:)
    aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >1ppjJ (J:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjJ (J:)
    fferafdqgadaiyehinegklwkhikhkyenk
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >1ppjN (N:)
    tatyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfve
    hlafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqnc
    sledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsra
    dlteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsq
    ichredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaat
    nklcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknl
    lrnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcp
    avagfgpieqlpdynrirsgmfwlrf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjN (N:)
    atyaqalqsvpetqvsqldnglrvaseqssqptctvgvwidagsryeseknngagyfveh
    lafkgtknrpgnalekevesmgahlnaystrehtayyikalskdlpkavelladivqncs
    ledsqiekerdvilqelqendtsmrdvvfnylhatafqgtplaqsvegpsenvrklsrad
    lteylsrhykaprmvlaaagglehrqlldlaqkhfsglsgtydedavptlspcrftgsqi
    chredglplahvaiavegpgwahpdnvalqvanaiighydctygggahlssplasiaatn
    klcqsfqtfnicyadtgllgahfvcdhmsiddmmfvlqgqwmrlctsatesevlrgknll
    rnalvshldgttpvcedigrslltygrriplaewesriaevdarvvrevcskyfydqcpa
    vagfgpieqlpdynrirsgmfw
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >1ppjO (O:)
    slkvapkvkateapagvpphpqdleftrlpnglviaslenyapasriglfikagsryens
    nnlgtshllrlasslttkgassfkitrgieavggklsvtstrenmaytveclrddvdilm
    efllnvttapefrrwevaalqpqlridkavalqnpqahvienlhaaayrnalanslycpd
    yrigkvtpvelhdyvqnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyh
    ggeireqngdslvhaalvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqava
    kgvhqpfdvsafnasysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaa
    knklkagylmsvessegfldevgsqalaagsytppstvlqqidavadadvinaakkfvsg
    rksmaasgnlghtpfidel
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjO (O:)
    evpphpqdleftrlpnglviaslenyapasriglfikagsryensnnlgtshllrlassl
    ttkgassfkitrgieavggklsvtstrenmaytveclrddvdilmefllnvttapefrrw
    evaalqpqlridkavalqnpqahvienlhaaayrnalanslycpdyrigkvtpvelhdyv
    qnhftsarmaliglgvshpvlkqvaeqflnirgglglsgakakyhggeireqngdslvha
    alvaesaaigsaeanafsvlqhvlgagphvkrgsnatsslyqavakgvhqpfdvsafnas
    ysdsglfgfytisqaasagdvikaaynqvktiaqgnlsnpdvqaaknklkagylmsvess
    egfldevgsqalaagsytppstvlqqidavadadvinaakkfvsgrksmaasgnlghtpf
    idel
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >1ppjP (P:)
    mtnirkshplmkivnnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtt
    tafssvthicrdvnygwiirymhangasmfficlymhvgrglyygsytfletwnigvill
    ltvmatafmgyvlpwgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffa
    fhfilpfiimaiamvhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalm
    llvlfapdllgdpdnytpanplntpphikpewyflfayailrsipnklggvlalafsili
    lalipllhtskqrsmmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfl
    lilvlmptagtienkllkw
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjP (P:)
    nnafidlpapsnisswwnfgsllgiclilqiltglflamhytsdtttafssvthicrdvn
    ygwiirymhangasmfficlymhvgrglyygsytfletwnigvillltvmatafmgyvlp
    wgqmsfwgatvitnllsaipyigtnlvewiwggfsvdkatltrffafhfilpfiimaiam
    vhllflhetgsnnptgissdvdkipfhpyytikdilgalllilalmllvlfapdllgdpd
    nytpanplntpphikpewyflfayailrsipnklggvlalafsililalipllhtskqrs
    mmfrplsqclfwalvadlltltwiggqpvehpyitigqlasvlyfllilvlmptagtien
    kllkw
    

  • Chain 'Q':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjQ (Q:)
    sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
    akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
    hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
    qvakdvctflrwaaepehdhrkrmglkmllmmglllplvyamkrhkwsvlksrklayrpp
    k
    

  • Chain 'R':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjR (R:)
    shtdikvpdfsdyrrpevldstksskessearkgfsylvtatttvgvayaaknvvsqfvs
    smsasadvlamskieiklsdipegknmafkwrgkplfvrhrtkkeidqeaavevsqlrdp
    qhdlervkkpewviligvcthlgcvpianagdfggyycpchgshydasgrirkgpaplnl
    evpsyeftsddmvivg
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >1ppjS (S:)
    agrpavsassrwlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvf
    rikraldlsmrqqilpkeqwtkyeedksylepylkevirerkereewakk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjS (S:)
    wlegirkwyynaagfnklglmrddtihenddvkeairrlpenlyddrvfrikraldlsmr
    qqilpkeqwtkyeedksylepylkevirerkereewakk
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1ppjT (T:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaayendr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjT (T:)
    grqfghltrvrhvityslspfeqrafphyfskgipnvlrrtracilrvappfvafylvyt
    wgtqefekskrknpaa
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >1ppjU (U:)
    gdpkeeeeeeeelvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelld
    flhardhcvahklfnslk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjU (U:)
    lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
    lfnslk
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >1ppjV (V:)
    mlsvaarsgpfapvlsatsrgvagalrplvqaavpatsespvldlklsvlcreslrgqaa
    grplvasvslnvpasvry
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ppjV (V:)
    aavpatsespvlsvlcreslrgqaagrplvasvslnvpasvry
    

  • Chain 'W':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ppjW (W:)
    vaptltarlysllfrrtstfaltivvgalfferafdqgadaiyehinegklwkhikhkye
    nk