SCOP 1.69: Domain d1ppju_: 1ppj U:

Lineage for d1ppju_ (1ppj U:)

1. Root: SCOP 1.69

2. Class f: Membrane and cell surface proteins and peptides [56835] (47 folds)

3. Fold f.28: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81532] (1 superfamily)
   membrane-associated alpha-helical protein; no transmembrane helices

4. Superfamily f.28.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81531] (1 family)
   location - intermembrane side of the bc1 complex

5. Family f.28.1.1: Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81530] (1 protein)
   "acidic/hinge protein", essential for the complex formation, interacts with the functional domain of cytochrome c1

6. Protein Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81529] (3 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81526] (12 PDB entries)

8. Domain d1ppju_: 1ppj U: [104279]
   Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd1, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq1, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppjv_, d1ppjw_

Details for d1ppju_

PDB Entry: 1ppj, 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin

SCOP Domain Sequences for d1ppju_:

Sequence; same for both SEQRES and ATOM records:

>d1ppju_ f.28.1.1 (U:) Non-heme 11 kDa protein of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) {Cow (Bos taurus)}
lvdplttvreqceqlekcvkarerlelcdervssrsqteedcteelldflhardhcvahk
lfnslk

Timeline for d1ppju_:

• d1ppju_ is new in SCOP 1.69
  
• d1ppju_ appears in SCOP 1.71
  
• d1ppju_ appears in the current release, SCOPe 2.08