Lineage for d1ppjq1 (1ppj Q:1-195)

  1. Root: SCOP 1.69
  2. 436025Class a: All alpha proteins [46456] (218 folds)
  3. 437666Fold a.3: Cytochrome c [46625] (1 superfamily)
    core: 3 helices; folded leaf, opened
  4. 437667Superfamily a.3.1: Cytochrome c [46626] (8 families) (S)
    covalently-bound heme completes the core
  5. 437983Family a.3.1.3: Cytochrome bc1 domain [46676] (1 protein)
  6. 437984Protein Cytochrome bc1 domain [46677] (3 species)
  7. 437995Species Cow (Bos taurus) [TaxId:9913] [46678] (12 PDB entries)
  8. 437998Domain d1ppjq1: 1ppj Q:1-195 [104273]
    Other proteins in same PDB: d1ppja1, d1ppja2, d1ppjb1, d1ppjb2, d1ppjc1, d1ppjc2, d1ppjd2, d1ppje1, d1ppje2, d1ppjf_, d1ppjg_, d1ppjh_, d1ppji_, d1ppjj_, d1ppjn1, d1ppjn2, d1ppjo1, d1ppjo2, d1ppjp1, d1ppjp2, d1ppjq2, d1ppjr1, d1ppjr2, d1ppjs_, d1ppjt_, d1ppju_, d1ppjv_, d1ppjw_

Details for d1ppjq1

PDB Entry: 1ppj (more details), 2.1 Å

PDB Description: bovine cytochrome bc1 complex with stigmatellin and antimycin
PDB Compounds: (Q:)

SCOP Domain Sequences for d1ppjq1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ppjq1 a.3.1.3 (Q:1-195) Cytochrome bc1 domain {Cow (Bos taurus)}
sdlelhppsypwshrgllssldhtsirrgfqvykqvcsschsmdyvayrhlvgvcytede
akalaeevevqdgpnedgemfmrpgklsdyfpkpypnpeaaraanngalppdlsyivrar
hggedyvfslltgycepptgvslreglyfnpyfpgqaigmappiynevlefddgtpatms
qvakdvctflrwaae

SCOP Domain Coordinates for d1ppjq1:

Click to download the PDB-style file with coordinates for d1ppjq1.
(The format of our PDB-style files is described here.)

Timeline for d1ppjq1: