![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) ![]() |
![]() | Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
![]() | Protein automated matches [254432] (4 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries) |
![]() | Domain d3l70e1: 3l70 E:1-69 [260679] Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1bcce2 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70e1 f.23.12.0 (E:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis slsasadvl
Timeline for d3l70e1: