Lineage for d3l70r1 (3l70 R:1-69)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025862Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) (S)
  5. 3025917Family f.23.12.0: automated matches [254198] (1 protein)
    not a true family
  6. 3025918Protein automated matches [254432] (4 species)
    not a true protein
  7. 3025923Species Chicken (Gallus gallus) [TaxId:9031] [260678] (8 PDB entries)
  8. 3025925Domain d3l70r1: 3l70 R:1-69 [262291]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_
    automated match to d3l70e1
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70r1

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (R:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l70r1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70r1 f.23.12.0 (R:1-69) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

SCOPe Domain Coordinates for d3l70r1:

Click to download the PDB-style file with coordinates for d3l70r1.
(The format of our PDB-style files is described here.)

Timeline for d3l70r1: