Lineage for d3l70t_ (3l70 T:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025949Superfamily f.23.13: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81508] (1 family) (S)
    automatically mapped to Pfam PF02939
  5. 3025950Family f.23.13.1: Ubiquinone-binding protein QP-C of cytochrome bc1 complex (Ubiquinol-cytochrome c reductase) [81507] (2 proteins)
  6. 3025997Protein automated matches [191133] (1 species)
    not a true protein
  7. 3025998Species Chicken (Gallus gallus) [TaxId:9031] [189229] (8 PDB entries)
  8. 3026000Domain d3l70t_: 3l70 T: [180014]
    Other proteins in same PDB: d3l70a1, d3l70a2, d3l70b1, d3l70b2, d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70h_, d3l70j_, d3l70n1, d3l70o1, d3l70o2, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70u_, d3l70w_
    automated match to d1be3g_
    complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70t_

PDB Entry: 3l70 (more details), 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound
PDB Compounds: (T:) Mitochondrial ubiquinol-cytochrome c reductase ubiquinone-binding protein qp-c

SCOPe Domain Sequences for d3l70t_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3l70t_ f.23.13.1 (T:) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
ihfgnlarvrhiityslspfeqraipnifsdalpnvwrrfssqvfkvappflgayllysw
gtqeferlkrknpadyend

SCOPe Domain Coordinates for d3l70t_:

Click to download the PDB-style file with coordinates for d3l70t_.
(The format of our PDB-style files is described here.)

Timeline for d3l70t_: