![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.185: LuxS/MPP-like metallohydrolase [63410] (1 superfamily) core: beta-alpha-beta(2)-alpha(2); 2 layers: alpha/beta |
![]() | Superfamily d.185.1: LuxS/MPP-like metallohydrolase [63411] (3 families) ![]() Share the same "active site motif" HxxEH located in the first core helix, but differ in one of the zinc-binding residues |
![]() | Family d.185.1.0: automated matches [232765] (1 protein) not a true family |
![]() | Protein automated matches [232766] (2 species) not a true protein |
![]() | Species Chicken (Gallus gallus) [TaxId:9031] [232768] (8 PDB entries) |
![]() | Domain d3l70a2: 3l70 A:234-444 [232806] Other proteins in same PDB: d3l70c1, d3l70c2, d3l70d1, d3l70d2, d3l70e1, d3l70e2, d3l70f_, d3l70g_, d3l70h_, d3l70j_, d3l70p1, d3l70p2, d3l70q1, d3l70q2, d3l70r1, d3l70r2, d3l70s_, d3l70t_, d3l70u_, d3l70w_ automated match to d1ntma2 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70a2 d.185.1.0 (A:234-444) automated matches {Chicken (Gallus gallus) [TaxId: 9031]} crftgseirarddalpvahvalavegpgwadpdnvvlhvanaiigrydrtfgggkhlssr laalavehklchsfqtfntsysdtglfgfhfvadplsiddmmfcaqgewmrlctsttese vkraknhlrsamvaqldgttpvcetigshllnygrrisleewdsrisavdarmvrdvcsk yiydkcpalaavgpieqlldynrirsgmywi
Timeline for d3l70a2: