SCOPe 2.04: Domain d3l70e1: 3l70 E:1-69

Lineage for d3l70e1 (3l70 E:1-69)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.23: Single transmembrane helix [81407] (38 superfamilies)
   not a true fold

4. Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families)

5. Family f.23.12.0: automated matches [254198] (1 protein)
   not a true family

6. Protein automated matches [254432] (4 species)
   not a true protein

7. Species Gallus gallus [TaxId:9031] [260678] (1 PDB entry)

8. Domain d3l70e1: 3l70 E:1-69 [260679]
   Other proteins in same PDB: d3l70e2
   automated match to d1bcce2
   complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq

Details for d3l70e1

PDB Entry: 3l70, 2.75 Å

PDB Description: cytochrome bc1 complex from chicken with trifloxystrobin bound

PDB Compounds: (E:) Cytochrome b-c1 complex subunit Rieske, mitochondrial

SCOPe Domain Sequences for d3l70e1:

Sequence; same for both SEQRES and ATOM records:

>d3l70e1 f.23.12.0 (E:1-69) automated matches {Gallus gallus [TaxId: 9031]}
vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis
slsasadvl

Timeline for d3l70e1:

• d3l70e1 is new in SCOPe 2.04-stable
  
• d3l70e1 appears in SCOPe 2.05
  
• d3l70e1 appears in the current release, SCOPe 2.08