Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
Fold f.23: Single transmembrane helix [81407] (38 superfamilies) not a true fold |
Superfamily f.23.12: ISP transmembrane anchor [81502] (2 families) |
Family f.23.12.0: automated matches [254198] (1 protein) not a true family |
Protein automated matches [254432] (4 species) not a true protein |
Species Gallus gallus [TaxId:9031] [260678] (1 PDB entry) |
Domain d3l70e1: 3l70 E:1-69 [260679] Other proteins in same PDB: d3l70e2 automated match to d1bcce2 complexed with bog, cdl, fes, gol, hec, hem, jzv, pee, uq |
PDB Entry: 3l70 (more details), 2.75 Å
SCOPe Domain Sequences for d3l70e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3l70e1 f.23.12.0 (E:1-69) automated matches {Gallus gallus [TaxId: 9031]} vhndvtvpdfsayrredvmdattssqtssedrkgfsylvtatacvatayaaknvvtqfis slsasadvl
Timeline for d3l70e1: