Lineage for d1lnqh2 (1lnq H:19-98)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3023597Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. 3023598Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. 3023599Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. 3023705Protein Potassium channel-related protein MthK [75643] (1 species)
    calcium gated potassium channel
  7. 3023706Species Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)
  8. 3023714Domain d1lnqh2: 1lnq H:19-98 [74064]
    Other proteins in same PDB: d1lnqa3, d1lnqa4, d1lnqb3, d1lnqb4, d1lnqc3, d1lnqc4, d1lnqd3, d1lnqd4, d1lnqe3, d1lnqe4, d1lnqf3, d1lnqf4, d1lnqg3, d1lnqg4, d1lnqh3, d1lnqh4
    complexed with ca

Details for d1lnqh2

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a
PDB Compounds: (H:) potassium channel related protein

SCOPe Domain Sequences for d1lnqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqh2 f.14.1.1 (H:19-98) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

SCOPe Domain Coordinates for d1lnqh2:

Click to download the PDB-style file with coordinates for d1lnqh2.
(The format of our PDB-style files is described here.)

Timeline for d1lnqh2: