Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.14: Gated ion channels [81325] (2 superfamilies) oligomeric transmembrane alpha-helical proteins |
Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) Pfam PF00520 |
Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins) |
Protein Potassium channel-related protein MthK [75643] (1 species) calcium gated potassium channel |
Species Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry) |
Domain d1lnqh2: 1lnq H:19-98 [74064] Other proteins in same PDB: d1lnqa3, d1lnqa4, d1lnqb3, d1lnqb4, d1lnqc3, d1lnqc4, d1lnqd3, d1lnqd4, d1lnqe3, d1lnqe4, d1lnqf3, d1lnqf4, d1lnqg3, d1lnqg4, d1lnqh3, d1lnqh4 complexed with ca |
PDB Entry: 1lnq (more details), 3.3 Å
SCOPe Domain Sequences for d1lnqh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lnqh2 f.14.1.1 (H:19-98) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]} patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt livlgigtfavaverllefl
Timeline for d1lnqh2: