Lineage for d1lnqb4 (1lnq B:245-336)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 3009722Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
    beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold
  4. 3009723Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families) (S)
  5. 3009724Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
    Pfam PF02080
  6. 3009731Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)
  7. 3009732Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries)
  8. 3009747Domain d1lnqb4: 1lnq B:245-336 [111579]
    Other proteins in same PDB: d1lnqa2, d1lnqa3, d1lnqb2, d1lnqb3, d1lnqc2, d1lnqc3, d1lnqd2, d1lnqd3, d1lnqe2, d1lnqe3, d1lnqf2, d1lnqf3, d1lnqg2, d1lnqg3, d1lnqh2, d1lnqh3
    complexed with ca

Details for d1lnqb4

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a
PDB Compounds: (B:) potassium channel related protein

SCOPe Domain Sequences for d1lnqb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqb4 d.286.1.1 (B:245-336) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

SCOPe Domain Coordinates for d1lnqb4:

Click to download the PDB-style file with coordinates for d1lnqb4.
(The format of our PDB-style files is described here.)

Timeline for d1lnqb4: