SCOPe 2.08: Domain d1lnqd4: 1lnq D:245-336

Lineage for d1lnqd4 (1lnq D:245-336)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.286: TrkA C-terminal domain-like [116725] (1 superfamily)
   beta-X-beta(2)-X-beta-alpha; pseudo barrel capped by helix at one end; topological similarity to the HPr-like fold

4. Superfamily d.286.1: TrkA C-terminal domain-like [116726] (2 families)

5. Family d.286.1.1: TrkA C-terminal domain-like [116727] (2 proteins)
   Pfam PF02080

6. Protein Potassium channel-related protein MthK, C-terminal domain [116728] (1 species)

7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [116729] (5 PDB entries)

8. Domain d1lnqd4: 1lnq D:245-336 [111583]
   Other proteins in same PDB: d1lnqa2, d1lnqa3, d1lnqb2, d1lnqb3, d1lnqc2, d1lnqc3, d1lnqd2, d1lnqd3, d1lnqe2, d1lnqe3, d1lnqf2, d1lnqf3, d1lnqg2, d1lnqg3, d1lnqh2, d1lnqh3
   complexed with ca

Details for d1lnqd4

PDB Entry: 1lnq, 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

PDB Compounds: (D:) potassium channel related protein

SCOPe Domain Sequences for d1lnqd4:

Sequence; same for both SEQRES and ATOM records:

>d1lnqd4 d.286.1.1 (D:245-336) Potassium channel-related protein MthK, C-terminal domain {Methanothermobacter thermautotrophicus [TaxId: 145262]}
dgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgdelii
dpprdysfragdiilgigkpeeierlknyisa

Timeline for d1lnqd4:

• d1lnqd4 first appeared in SCOP 1.71
  
• d1lnqd4 appears in SCOPe 2.07