PDB entry 1lnq

View 1lnq on RCSB PDB site
Description: crystal structure of mthk at 3.3 a
Class: metal transport
Keywords: rossmann fold, helix bundle, membrane protein, METAL TRANSPORT
Deposited on 2002-05-03, released 2002-06-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 3.3 Å
R-factor: 0.30100000000000005
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqa2, d1lnqa3, d1lnqa4
  • Chain 'B':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqb2, d1lnqb3, d1lnqb4
  • Chain 'C':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqc2, d1lnqc3, d1lnqc4
  • Chain 'D':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqd2, d1lnqd3, d1lnqd4
  • Chain 'E':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqe2, d1lnqe3, d1lnqe4
  • Chain 'F':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqf2, d1lnqf3, d1lnqf4
  • Chain 'G':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqg2, d1lnqg3, d1lnqg4
  • Chain 'H':
    Compound: potassium channel related protein
    Species: Methanothermobacter thermautotrophicus [TaxId:145262]
    Gene: mth1520
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1lnqh2, d1lnqh3, d1lnqh4
  • Heterogens: CA

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1lnqA (A:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqA (A:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1lnqB (B:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqB (B:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1lnqC (C:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqC (C:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1lnqD (D:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqD (D:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1lnqE (E:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqE (E:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >1lnqF (F:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqF (F:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >1lnqG (G:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqG (G:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1lnqH (H:)
    mvlvieiirkhlprvlkvpatrilllvlaviiygtagfhfiegeswtvslywtfvtiatv
    gygdyspstplgmyftvtlivlgigtfavaverlleflinreqmklmglidvaksrhvvi
    cgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanvrgara
    vivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvisgrlms
    rsiddgyeamfvqdvlaeestrrmvevpipegsklegvsvldadihdvtgviiigvgrgd
    eliidpprdysfragdiilgigkpeeierlknyisa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1lnqH (H:)
    patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
    livlgigtfavaverlleflrhvvicgwsestleclrelrgsevfvlaedenvrkkvlrs
    ganfvhgdptrvsdlekanvrgaravivdlesdsetihcilgirkidesvriiaeaerye
    nieqlrmagadqvispfvisgrlmsrsiddgyeamfvqdvlaeestrrmvevpipegskl
    egvsvldadihdvtgviiigvgrgdeliidpprdysfragdiilgigkpeeierlknyis
    a