Lineage for d1lnqc3 (1lnq C:116-244)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845624Family c.2.1.9: Potassium channel NAD-binding domain [63944] (5 proteins)
    automatically mapped to Pfam PF02254
  6. 2845647Protein Potassium channel-related protein MthK [75122] (1 species)
  7. 2845648Species Methanothermobacter thermautotrophicus [TaxId:145262] [75123] (5 PDB entries)
  8. 2845664Domain d1lnqc3: 1lnq C:116-244 [111580]
    Other proteins in same PDB: d1lnqa2, d1lnqa4, d1lnqb2, d1lnqb4, d1lnqc2, d1lnqc4, d1lnqd2, d1lnqd4, d1lnqe2, d1lnqe4, d1lnqf2, d1lnqf4, d1lnqg2, d1lnqg4, d1lnqh2, d1lnqh4
    complexed with ca

Details for d1lnqc3

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a
PDB Compounds: (C:) potassium channel related protein

SCOPe Domain Sequences for d1lnqc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqc3 c.2.1.9 (C:116-244) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
rhvvicgwsestleclrelrgsevfvlaedenvrkkvlrsganfvhgdptrvsdlekanv
rgaravivdlesdsetihcilgirkidesvriiaeaeryenieqlrmagadqvispfvis
grlmsrsid

SCOPe Domain Coordinates for d1lnqc3:

Click to download the PDB-style file with coordinates for d1lnqc3.
(The format of our PDB-style files is described here.)

Timeline for d1lnqc3: