Lineage for d1lnqd2 (1lnq D:19-98)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.14: Gated ion channels [81325] (2 superfamilies)
    oligomeric transmembrane alpha-helical proteins
  4. Superfamily f.14.1: Voltage-gated ion channels [81324] (5 families) (S)
    Pfam PF00520
  5. Family f.14.1.1: Voltage-gated potassium channels [81323] (6 proteins)
  6. Protein Potassium channel-related protein MthK [75643] (1 species)
    calcium gated potassium channel
  7. Species Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)
  8. Domain d1lnqd2: 1lnq D:19-98 [74056]
    Other proteins in same PDB: d1lnqa3, d1lnqa4, d1lnqb3, d1lnqb4, d1lnqc3, d1lnqc4, d1lnqd3, d1lnqd4, d1lnqe3, d1lnqe4, d1lnqf3, d1lnqf4, d1lnqg3, d1lnqg4, d1lnqh3, d1lnqh4
    complexed with ca

Details for d1lnqd2

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a
PDB Compounds: (D:) potassium channel related protein

SCOPe Domain Sequences for d1lnqd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqd2 f.14.1.1 (D:19-98) Potassium channel-related protein MthK {Methanothermobacter thermautotrophicus [TaxId: 145262]}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

SCOPe Domain Coordinates for d1lnqd2 are not available.

Timeline for d1lnqd2:

Domains from same chain:
(mouse over for more information)
d1lnqd3, d1lnqd4
Domains from other chains:
(mouse over for more information)
d1lnqa2, d1lnqa3, d1lnqa4, d1lnqb2, d1lnqb3, d1lnqb4, d1lnqc2, d1lnqc3, d1lnqc4, d1lnqe2, d1lnqe3, d1lnqe4, d1lnqf2, d1lnqf3, d1lnqf4, d1lnqg2, d1lnqg3, d1lnqg4, d1lnqh2, d1lnqh3, d1lnqh4