Lineage for d1lnqh2 (1lnq H:19-98)

  1. Root: SCOP 1.61
  2. 201426Class f: Membrane and cell surface proteins and peptides [56835] (12 folds)
  3. 201495Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 201496Superfamily f.2.1: Membrane all-alpha [56869] (13 families) (S)
  5. 201976Family f.2.1.11: Oligomeric gated channels [63383] (4 proteins)
  6. 202012Protein Potassium channel-related protein MthK [75643] (1 species)
  7. 202013Species Archaeon Methanothermobacter thermautotrophicus [TaxId:145262] [75644] (1 PDB entry)
  8. 202021Domain d1lnqh2: 1lnq H:19-98 [74064]
    Other proteins in same PDB: d1lnqa1, d1lnqb1, d1lnqc1, d1lnqd1, d1lnqe1, d1lnqf1, d1lnqg1, d1lnqh1

Details for d1lnqh2

PDB Entry: 1lnq (more details), 3.3 Å

PDB Description: crystal structure of mthk at 3.3 a

SCOP Domain Sequences for d1lnqh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lnqh2 f.2.1.11 (H:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus}
patrilllvlaviiygtagfhfiegeswtvslywtfvtiatvgygdyspstplgmyftvt
livlgigtfavaverllefl

SCOP Domain Coordinates for d1lnqh2:

Click to download the PDB-style file with coordinates for d1lnqh2.
(The format of our PDB-style files is described here.)

Timeline for d1lnqh2: