![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
![]() | Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) ![]() |
![]() | Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein) |
![]() | Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species) |
![]() | Species Thermochromatium tepidum [TaxId:1050] [81487] (1 PDB entry) |
![]() | Domain d1eysh2: 1eys H:7-43 [43517] Other proteins in same PDB: d1eysc_, d1eysh1, d1eysl_, d1eysm_ complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef |
PDB Entry: 1eys (more details), 2.2 Å
SCOPe Domain Sequences for d1eysh2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysh2 f.23.10.1 (H:7-43) Photosystem II reaction centre subunit H, transmembrane region {Thermochromatium tepidum [TaxId: 1050]} hyidaaqitiwafwlfffgliiylrredkregyplds
Timeline for d1eysh2: