Lineage for d1eysh2 (1eys H:7-43)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025632Superfamily f.23.10: Photosystem II reaction centre subunit H, transmembrane region [81490] (2 families) (S)
  5. 3025633Family f.23.10.1: Photosystem II reaction centre subunit H, transmembrane region [81489] (1 protein)
  6. 3025634Protein Photosystem II reaction centre subunit H, transmembrane region [81488] (4 species)
  7. 3025760Species Thermochromatium tepidum [TaxId:1050] [81487] (1 PDB entry)
  8. 3025761Domain d1eysh2: 1eys H:7-43 [43517]
    Other proteins in same PDB: d1eysc_, d1eysh1, d1eysl_, d1eysm_
    complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysh2

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum
PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysh2 f.23.10.1 (H:7-43) Photosystem II reaction centre subunit H, transmembrane region {Thermochromatium tepidum [TaxId: 1050]}
hyidaaqitiwafwlfffgliiylrredkregyplds

SCOPe Domain Coordinates for d1eysh2:

Click to download the PDB-style file with coordinates for d1eysh2.
(The format of our PDB-style files is described here.)

Timeline for d1eysh2: