PDB entry 1eys

View 1eys on RCSB PDB site
Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum
Class: electron transport
Keywords: membrane protein complex, electron transport
Deposited on 2000-05-08, released 2000-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.231
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: photosynthetic reaction center
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EYS (0-End)
    Domains in SCOPe 2.07: d1eysc_
  • Chain 'H':
    Compound: photosynthetic reaction center
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1eysh1, d1eysh2
  • Chain 'L':
    Compound: photosynthetic reaction center
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EYS (0-279)
    Domains in SCOPe 2.07: d1eysl_
  • Chain 'M':
    Compound: photosynthetic reaction center
    Species: Thermochromatium tepidum [TaxId:1050]
    Database cross-references and differences (RAF-indexed):
    • PDB 1EYS (0-End)
    Domains in SCOPe 2.07: d1eysm_
  • Heterogens: BGL, FE, BCL, BPH, MQ8, HEM, CRT, LDA, PEF, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1eysC (C:)
    cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl
    kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk
    ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp
    fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs
    tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq
    makdypglyktavtqealpgsapaseaapaaateaapeapaqevpaaeavpaaaepgaae
    aagsvepapveevapapaaqrl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eysC (C:)
    cegpppgteqigyrgvgmenyyvkrqralsiqanqpveslpaadstgpkasevyqsvqvl
    kdlsvgeftrtmvavttwvspkegcnychvpgnwasddiytkvvsrrmfelvraansdwk
    ahvaetgvtcytchrgnpvpkyawvtdpgpkypsglkptgqnygsktvayaslpfdpltp
    fldqaneiritgnaalagsnpaslkqaewtfglmmnisdslgvgctschntrafndwtqs
    tpkrttawyairhvrdinqnyiwplndvlpasrkgpygdplrvscmtchqavnkplygaq
    makdypglyk
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >1eysH (H:)
    mpagithyidaaqitiwafwlfffgliiylrredkregypldsnrtersggrykvvgfpd
    lpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspdrp
    khcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepqir
    ylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedkvc
    ayyaggklyataeragpll
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eysH (H:)
    hyidaaqitiwafwlfffgliiylrredkregypldspdlpdpktfvlphnggtvvaprv
    eapvavnatpfspapgsplvpngdpmlsgfgpaaspdrpkhcdltfeglpkivpmrvake
    fsiaegdpdprgmtvvgldgevagtvsdvwvdrsepqirylevevaankkkvllpigfsr
    fdkkarkvkvdaikaahfanvptlsnpdqvtlyeedkvcayyaggklyataeragpll
    

  • Chain 'L':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1eysL (L:)
    amlsfekkyrvrggtliggdlfdfwvgpfyvgffgvvgfcftllgvllivwgatigptgp
    tsdlqtynlwrisiappdlsyglrmapltegglwqiiticaagafiswalreveicrklg
    igfhvpfafsfaigaylvlvfvrpllmgawghgfpygilshldwvsnvgyqflhfhynpa
    hmlaisffftnclalsmhgslilsvtnpqrgepvktsehentffrdivgysigalaihrl
    glflalsaafwsavcilisgpfwtrgwpewwnwwlelplw
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >1eysM (M:)
    peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
    ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwliaglf
    ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
    hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
    gtaaegaalfwrwtmgfnatmesihrwawwcavltvitagigillsgtvvdnwylwavkh
    gmapaypevvtavnpyetaaevmq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1eysM (M:)
    peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi
    ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwliaglf
    ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp
    hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr
    gtaaegaalfwrwtmgfnatmesihrwawwcavltvitagigillsgtvvdnwylwavkh
    gmapaypevvtavnpyet