Lineage for d1eysh2 (1eys H:7-43)

  1. Root: SCOP 1.55
  2. 38777Class f: Membrane and cell surface proteins and peptides [56835] (11 folds)
  3. 38834Fold f.2: Membrane all-alpha [56868] (1 superfamily)
  4. 38835Superfamily f.2.1: Membrane all-alpha [56869] (10 families) (S)
  5. 38873Family f.2.1.2: Photosynthetic reaction centre, L-, M- and H-chains [56878] (1 protein)
  6. 38874Protein Photosynthetic reaction centre, L-, M- and H-chains [56879] (3 species)
  7. 38961Species Thermochromatium tepidum [TaxId:1050] [56882] (1 PDB entry)
  8. 38962Domain d1eysh2: 1eys H:7-43 [43517]
    Other proteins in same PDB: d1eysc_, d1eysh1

Details for d1eysh2

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

SCOP Domain Sequences for d1eysh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysh2 f.2.1.2 (H:7-43) Photosynthetic reaction centre, L-, M- and H-chains {Thermochromatium tepidum}
hyidaaqitiwafwlfffgliiylrredkregyplds

SCOP Domain Coordinates for d1eysh2:

Click to download the PDB-style file with coordinates for d1eysh2.
(The format of our PDB-style files is described here.)

Timeline for d1eysh2: