SCOPe 2.08: Domain d1eysh1: 1eys H:59-259

Lineage for d1eysh1 (1eys H:59-259)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.41: PRC-barrel domain [50345] (1 superfamily)
   core: barrel, partly opened; n*=5, S*=8; meander

4. Superfamily b.41.1: PRC-barrel domain [50346] (5 families)

5. Family b.41.1.1: Photosynthetic reaction centre, H-chain, cytoplasmic domain [50347] (2 proteins)

6. Protein Photosynthetic reaction centre [50348] (4 species)

7. Species Thermochromatium tepidum [TaxId:1050] [50351] (1 PDB entry)

8. Domain d1eysh1: 1eys H:59-259 [25484]
   Other proteins in same PDB: d1eysc_, d1eysh2, d1eysl_, d1eysm_
   complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysh1

PDB Entry: 1eys, 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

PDB Compounds: (H:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysh1:

Sequence; same for both SEQRES and ATOM records:

>d1eysh1 b.41.1.1 (H:59-259) Photosynthetic reaction centre {Thermochromatium tepidum [TaxId: 1050]}
pdlpdpktfvlphnggtvvaprveapvavnatpfspapgsplvpngdpmlsgfgpaaspd
rpkhcdltfeglpkivpmrvakefsiaegdpdprgmtvvgldgevagtvsdvwvdrsepq
irylevevaankkkvllpigfsrfdkkarkvkvdaikaahfanvptlsnpdqvtlyeedk
vcayyaggklyataeragpll

Timeline for d1eysh1:

• d1eysh1 first appeared (with stable ids) in SCOP 1.55
  
• d1eysh1 appears in SCOPe 2.07