SCOPe 2.08: Domain d1eysl_: 1eys L:

Lineage for d1eysl_ (1eys L:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)
   automatically mapped to Pfam PF00124

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein L (light) subunit [81477] (4 species)

7. Species Thermochromatium tepidum [TaxId:1050] [81476] (1 PDB entry)

8. Domain d1eysl_: 1eys L: [43515]
   Other proteins in same PDB: d1eysc_, d1eysh1, d1eysh2, d1eysm_
   complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysl_

PDB Entry: 1eys, 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum

PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysl_:

Sequence; same for both SEQRES and ATOM records:

>d1eysl_ f.26.1.1 (L:) L (light) subunit {Thermochromatium tepidum [TaxId: 1050]}
amlsfekkyrvrggtliggdlfdfwvgpfyvgffgvvgfcftllgvllivwgatigptgp
tsdlqtynlwrisiappdlsyglrmapltegglwqiiticaagafiswalreveicrklg
igfhvpfafsfaigaylvlvfvrpllmgawghgfpygilshldwvsnvgyqflhfhynpa
hmlaisffftnclalsmhgslilsvtnpqrgepvktsehentffrdivgysigalaihrl
glflalsaafwsavcilisgpfwtrgwpewwnwwlelplw

Timeline for d1eysl_:

• d1eysl_ first appeared (with stable ids) in SCOP 1.55, called d1eysl1
  
• d1eysl_ appears in SCOPe 2.07