Lineage for d1eysl_ (1eys L:)

  1. Root: SCOPe 2.08
  2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
    five transmembrane helices forming a sheet-like structure
  4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) (S)
    automatically mapped to Pfam PF00124
  5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
    L and M are probably related to each other
  6. Protein L (light) subunit [81477] (3 species)
  7. Species Thermochromatium tepidum [TaxId:1050] [81476] (1 PDB entry)
  8. Domain d1eysl_: 1eys L: [43515]
    Other proteins in same PDB: d1eysc_, d1eysh1, d1eysh2, d1eysm_
    complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef

Details for d1eysl_

PDB Entry: 1eys (more details), 2.2 Å

PDB Description: crystal structure of photosynthetic reaction center from a thermophilic bacterium, thermochromatium tepidum
PDB Compounds: (L:) photosynthetic reaction center

SCOPe Domain Sequences for d1eysl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1eysl_ f.26.1.1 (L:) L (light) subunit {Thermochromatium tepidum [TaxId: 1050]}
amlsfekkyrvrggtliggdlfdfwvgpfyvgffgvvgfcftllgvllivwgatigptgp
tsdlqtynlwrisiappdlsyglrmapltegglwqiiticaagafiswalreveicrklg
igfhvpfafsfaigaylvlvfvrpllmgawghgfpygilshldwvsnvgyqflhfhynpa
hmlaisffftnclalsmhgslilsvtnpqrgepvktsehentffrdivgysigalaihrl
glflalsaafwsavcilisgpfwtrgwpewwnwwlelplw

SCOPe Domain Coordinates for d1eysl_ are not available.

Timeline for d1eysl_:

Domains from other chains:
(mouse over for more information)
d1eysc_, d1eysh1, d1eysh2, d1eysm_