![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily) five transmembrane helices forming a sheet-like structure |
![]() | Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family) ![]() automatically mapped to Pfam PF00124 |
![]() | Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins) L and M are probably related to each other |
![]() | Protein M (medium) subunit [81481] (4 species) |
![]() | Species Thermochromatium tepidum [TaxId:1050] [81480] (1 PDB entry) |
![]() | Domain d1eysm_: 1eys M: [43516] Other proteins in same PDB: d1eysc_, d1eysh1, d1eysh2, d1eysl_ complexed with bcl, bgl, bph, crt, fe, hem, lda, mq8, pef |
PDB Entry: 1eys (more details), 2.2 Å
SCOPe Domain Sequences for d1eysm_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1eysm_ f.26.1.1 (M:) M (medium) subunit {Thermochromatium tepidum [TaxId: 1050]} peyqniftavqvrapaypgvplpkgnlprigrpifsywlgkigdaqigpiylgltgtlsi ffglvaisiigfnmlasvhwdvfqflkhffwlgleppppqyglripplseggwwliaglf ltlsillwwvrtykraealgmsqhlswafaaaiffylvlgfirpvmmgswakavpfgifp hldwtaafsirygnlyynpfhmlsiaflygsallfamhgatilsvsrfggdreidqithr gtaaegaalfwrwtmgfnatmesihrwawwcavltvitagigillsgtvvdnwylwavkh gmapaypevvtavnpyet
Timeline for d1eysm_:
![]() Domains from other chains: (mouse over for more information) d1eysc_, d1eysh1, d1eysh2, d1eysl_ |