SCOPe 2.08: Domain d7ev7t_: 7ev7 T:

Lineage for d7ev7t_ (7ev7 T:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
   not a true fold
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.23.2: Mitochondrial cytochrome c oxidase subunit VIa [81411] (1 family)
   automatically mapped to Pfam PF02046

5. Family f.23.2.1: Mitochondrial cytochrome c oxidase subunit VIa [81410] (2 proteins)

6. Protein Mitochondrial cytochrome c oxidase subunit VIa [81409] (1 species)
   probably responsible for the dimerization of the mitochondrial cytochrome c oxidase

7. Species Cow (Bos taurus) [TaxId:9913] [81408] (56 PDB entries)

8. Domain d7ev7t_: 7ev7 T: [418125]
   Other proteins in same PDB: d7ev7a_, d7ev7b1, d7ev7b2, d7ev7c_, d7ev7d_, d7ev7e_, d7ev7f_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7p_, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7u_, d7ev7v_, d7ev7w_, d7ev7x_, d7ev7y_, d7ev7z_
   automated match to d3ag3g_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7ev7t_

PDB Entry: 7ev7, 1.7 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at a 50 k

PDB Compounds: (T:) Cytochrome c oxidase subunit 6A2

SCOPe Domain Sequences for d7ev7t_:

Sequence; same for both SEQRES and ATOM records:

>d7ev7t_ f.23.2.1 (T:) Mitochondrial cytochrome c oxidase subunit VIa {Cow (Bos taurus) [TaxId: 9913]}
asaakgdhggtgartwrfltfglalpsvalctlnswlhsghrerpafipyhhlrirtkpf
swgdgnhtffhnprvnplptgyek

Timeline for d7ev7t_:

• d7ev7t_ is new in SCOPe 2.08-stable