Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.4: Mitochondrial cytochrome c oxidase subunit VIIa [81419] (1 family) automatically mapped to Pfam PF02238 |
Family f.23.4.1: Mitochondrial cytochrome c oxidase subunit VIIa [81418] (2 proteins) |
Protein Mitochondrial cytochrome c oxidase subunit VIIa [81417] (1 species) function unknown, probably acts as a regulator or is required for the assembly |
Species Cow (Bos taurus) [TaxId:9913] [81416] (56 PDB entries) |
Domain d7ev7w_: 7ev7 W: [418128] Other proteins in same PDB: d7ev7a_, d7ev7b1, d7ev7b2, d7ev7c_, d7ev7d_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7p_, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7x_, d7ev7y_, d7ev7z_ automated match to d3ag3j_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 7ev7 (more details), 1.7 Å
SCOPe Domain Sequences for d7ev7w_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ev7w_ f.23.4.1 (W:) Mitochondrial cytochrome c oxidase subunit VIIa {Cow (Bos taurus) [TaxId: 9913]} fenrvaekqklfqednglpvhlkggatdnilyrvtmtlclggtlyslyclgwasfphk
Timeline for d7ev7w_:
View in 3D Domains from other chains: (mouse over for more information) d7ev7a_, d7ev7b1, d7ev7b2, d7ev7c_, d7ev7d_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7p_, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7x_, d7ev7y_, d7ev7z_ |