SCOPe 2.08: Domain d7ev7b1: 7ev7 B:1-90

Lineage for d7ev7b1 (7ev7 B:1-90)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.17: Transmembrane helix hairpin [81334] (6 superfamilies)
   two antiparallel transmembrane helices

4. Superfamily f.17.2: Cytochrome c oxidase subunit II-like, transmembrane region [81464] (2 families)

5. Family f.17.2.1: Cytochrome c oxidase subunit II-like, transmembrane region [81463] (5 proteins)

6. Protein Mitochondrial cytochrome c oxidase, subunit II [81455] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81454] (50 PDB entries)

8. Domain d7ev7b1: 7ev7 B:1-90 [418105]
   Other proteins in same PDB: d7ev7a_, d7ev7b2, d7ev7c_, d7ev7d_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o2, d7ev7p_, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7w_, d7ev7x_, d7ev7y_, d7ev7z_
   automated match to d1occb2
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7ev7b1

PDB Entry: 7ev7, 1.7 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at a 50 k

PDB Compounds: (B:) Cytochrome c oxidase subunit 2

SCOPe Domain Sequences for d7ev7b1:

Sequence; same for both SEQRES and ATOM records:

>d7ev7b1 f.17.2.1 (B:1-90) Mitochondrial cytochrome c oxidase, subunit II {Cow (Bos taurus) [TaxId: 9913]}
maypmqlgfqdatspimeellhfhdhtlmivflisslvlyiislmlttklthtstmdaqe
vetiwtilpaiililialpslrilymmdei

Timeline for d7ev7b1:

• d7ev7b1 is new in SCOPe 2.08-stable