Lineage for d7ev7y_ (7ev7 Y:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3025361Superfamily f.23.6: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81427] (1 family) (S)
    automatically mapped to Pfam PF02935
  5. 3025362Family f.23.6.1: Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81426] (2 proteins)
  6. 3025363Protein Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) [81425] (1 species)
    function unknown, probably acts as a regulator or is required for the assembly
  7. 3025364Species Cow (Bos taurus) [TaxId:9913] [81424] (50 PDB entries)
  8. 3025406Domain d7ev7y_: 7ev7 Y: [418130]
    Other proteins in same PDB: d7ev7a_, d7ev7b1, d7ev7b2, d7ev7c_, d7ev7d_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7p_, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7w_, d7ev7x_, d7ev7z_
    automated match to d2occl_
    complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7ev7y_

PDB Entry: 7ev7 (more details), 1.7 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at a 50 k
PDB Compounds: (Y:) cytochrome c oxidase subunit 7c, mitochondrial

SCOPe Domain Sequences for d7ev7y_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7ev7y_ f.23.6.1 (Y:) Mitochondrial cytochrome c oxidase subunit VIIc (aka VIIIa) {Cow (Bos taurus) [TaxId: 9913]}
hyeegpgknipfsvenkwrllammtlffgsgfaapffivrhqllkk

SCOPe Domain Coordinates for d7ev7y_:

Click to download the PDB-style file with coordinates for d7ev7y_.
(The format of our PDB-style files is described here.)

Timeline for d7ev7y_:

  • d7ev7y_ is new in SCOPe 2.08-stable