| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.1: Mitochondrial cytochrome c oxidase subunit IV [81406] (1 family) ![]() automatically mapped to Pfam PF02936 |
| Family f.23.1.1: Mitochondrial cytochrome c oxidase subunit IV [81405] (2 proteins) |
| Protein automated matches [190270] (1 species) not a true protein |
| Species Cow (Bos taurus) [TaxId:9913] [187062] (26 PDB entries) |
| Domain d7ev7d_: 7ev7 D: [418108] Other proteins in same PDB: d7ev7a_, d7ev7b1, d7ev7b2, d7ev7c_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7p_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7w_, d7ev7x_, d7ev7y_, d7ev7z_ automated match to d1v54d_ complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn |
PDB Entry: 7ev7 (more details), 1.7 Å
SCOPe Domain Sequences for d7ev7d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7ev7d_ f.23.1.1 (D:) automated matches {Cow (Bos taurus) [TaxId: 9913]}
svvksedyalpsyvdrrdyplpdvahvknlsasqkalkekekaswsslsidekvelyrlk
fkesfaemnrstnewktvvgaamffigftallliwekhyvygpiphtfeeewvakqtkrm
ldmkvapiqgfsakwdydknewkk
Timeline for d7ev7d_:
View in 3DDomains from other chains: (mouse over for more information) d7ev7a_, d7ev7b1, d7ev7b2, d7ev7c_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7p_, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7w_, d7ev7x_, d7ev7y_, d7ev7z_ |