SCOPe 2.08: Domain d7ev7c_: 7ev7 C:

Lineage for d7ev7c_ (7ev7 C:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.25: Cytochrome c oxidase subunit III-like [81453] (1 superfamily)
   core: 7 transmembrane helices organized into two bundles, one formed by the first two helices and the other by the rest

4. Superfamily f.25.1: Cytochrome c oxidase subunit III-like [81452] (2 families)
   automatically mapped to Pfam PF00510

5. Family f.25.1.1: Cytochrome c oxidase subunit III-like [81451] (3 proteins)
   function unknown, possibly involved in the assembly or form the entrance to "oxygen" channel

6. Protein Mitochondrial cytochrome c oxidase, subunit III [81445] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [81444] (57 PDB entries)

8. Domain d7ev7c_: 7ev7 C: [418107]
   Other proteins in same PDB: d7ev7a_, d7ev7b1, d7ev7b2, d7ev7d_, d7ev7e_, d7ev7f_, d7ev7g_, d7ev7h_, d7ev7i_, d7ev7j_, d7ev7k_, d7ev7l_, d7ev7m_, d7ev7n_, d7ev7o1, d7ev7o2, d7ev7q_, d7ev7r_, d7ev7s_, d7ev7t_, d7ev7u_, d7ev7v_, d7ev7w_, d7ev7x_, d7ev7y_, d7ev7z_
   automated match to d2occc_
   complexed with cdl, chd, cmo, cu, cua, dmu, edo, hea, mg, na, pek, pgv, po4, psc, tgl, zn

Details for d7ev7c_

PDB Entry: 7ev7, 1.7 Å

PDB Description: bovine heart cytochrome c oxidase in the carbon monoxide-bound fully reduced state at a 50 k

PDB Compounds: (C:) Cytochrome c oxidase subunit 3

SCOPe Domain Sequences for d7ev7c_:

Sequence; same for both SEQRES and ATOM records:

>d7ev7c_ f.25.1.1 (C:) Mitochondrial cytochrome c oxidase, subunit III {Cow (Bos taurus) [TaxId: 9913]}
hqthayhmvnpspwpltgalsallmtsgltmwfhfnsmtllmiglttnmltmyqwwrdvi
restfqghhtpavqkglrygmilfiisevlfftgffwafyhsslaptpelggcwpptgih
plnplevpllntsvllasgvsitwahhslmegdrkhmlqalfititlgvyftllqaseyy
eapftisdgvygstffvatgfhglhviigstflivcffrqlkfhftsnhhfgfeaaawyw
hfvdvvwlflyvsiywwgs

Timeline for d7ev7c_:

• d7ev7c_ is new in SCOPe 2.08-stable