SCOPe 2.08: Domain d7edao_: 7eda O:

Lineage for d7edao_ (7eda O:)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies)
   not a true fold, gathers together transmembrane barrels of different (n,S)
   annotated by the SCOP(e) curators as 'not a true fold'

4. Superfamily f.4.1: OMPA-like [56925] (5 families)
   forms (8,10) barrel

5. Family f.4.1.4: PsbO-like [161115] (2 proteins)
   Pfam PF01716; MSP

6. Protein Manganese-stabilising protein, PsbO [161116] (2 species)

7. Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries)

8. Domain d7edao_: 7eda O: [418087]
   Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edat_, d7edau_, d7edax_
   automated match to d3wu2o_
   complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edao_

PDB Entry: 7eda, 2.78 Å

PDB Description: structure of monomeric photosystem ii

PDB Compounds: (O:) Photosystem II manganese-stabilizing polypeptide

SCOPe Domain Sequences for d7edao_:

Sequence, based on SEQRES records:

>d7edao_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqeaef
vptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftvknl
vastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeelara
nvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyasiep

Sequence, based on observed residues (ATOM records):

>d7edao_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]}
tyddivlankcpaypqtyriarlclqpflvkeetklvtrettsldqiqgelkvngsltfv
eedgidfqpvtvqmgeripllftvknlvastsittdfkgefnvpsyrtanfldpkgrgla
sgydsaialpqalaranvkrfsltkgqislnvkvdgeiagtfeseqlsdddmgahephev
kiqgvfyasiep

Timeline for d7edao_:

• d7edao_ is new in SCOPe 2.08-stable