Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.32: Photosystem II reaction center protein J, PsbJ [161021] (2 families) automatically mapped to Pfam PF01788 |
Family f.23.32.1: PsbJ-like [161022] (2 proteins) Pfam PF01788 |
Protein automated matches [191002] (3 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [189916] (25 PDB entries) |
Domain d7edaj_: 7eda J: [418083] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_ automated match to d5b66j_ complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edaj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edaj_ f.23.32.1 (J:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} ggriplwivatvagmgvivivglffygayaglgssl
Timeline for d7edaj_: