Lineage for d7edak_ (7eda K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026648Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 3026655Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries)
  8. 3026679Domain d7edak_: 7eda K: [418084]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_, d7edax_
    automated match to d2axtk1
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edak_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d7edak_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edak_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d7edak_:

Click to download the PDB-style file with coordinates for d7edak_.
(The format of our PDB-style files is described here.)

Timeline for d7edak_:

  • d7edak_ is new in SCOPe 2.08-stable