Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) automatically mapped to Pfam PF05151 |
Family f.23.35.1: PsbM-like [161034] (2 proteins) Pfam PF05151 |
Protein automated matches [196649] (5 species) not a true protein |
Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (7 PDB entries) |
Domain d7edam_: 7eda M: [418086] Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edao_, d7edat_, d7edau_, d7edax_ automated match to d2axtm1 complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl |
PDB Entry: 7eda (more details), 2.78 Å
SCOPe Domain Sequences for d7edam_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7edam_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]} vnqlgliatalfvlvpsvfliilyvqtesq
Timeline for d7edam_: