Lineage for d7edam_ (7eda M:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026592Superfamily f.23.35: Photosystem II reaction center protein M, PsbM [161033] (1 family) (S)
    automatically mapped to Pfam PF05151
  5. 3026593Family f.23.35.1: PsbM-like [161034] (2 proteins)
    Pfam PF05151
  6. 3026629Protein automated matches [196649] (5 species)
    not a true protein
  7. 3026638Species Thermosynechococcus vulcanus [TaxId:32053] [196650] (7 PDB entries)
  8. 3026642Domain d7edam_: 7eda M: [418086]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edao_, d7edat_, d7edau_, d7edax_
    automated match to d2axtm1
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edam_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (M:) Photosystem II reaction center protein M

SCOPe Domain Sequences for d7edam_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edam_ f.23.35.1 (M:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
vnqlgliatalfvlvpsvfliilyvqtesq

SCOPe Domain Coordinates for d7edam_:

Click to download the PDB-style file with coordinates for d7edam_.
(The format of our PDB-style files is described here.)

Timeline for d7edam_:

  • d7edam_ is new in SCOPe 2.08-stable