Lineage for d7edax_ (7eda X:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026852Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) (S)
    Pfam PF06596
  5. 3026853Family f.23.40.1: PsbX-like [267615] (2 proteins)
  6. 3026857Protein automated matches [267680] (2 species)
    not a true protein
  7. 3026871Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries)
  8. 3026895Domain d7edax_: 7eda X: [418090]
    Other proteins in same PDB: d7edaa_, d7edab_, d7edac_, d7edad_, d7edae_, d7edaf_, d7edah_, d7edaj_, d7edak_, d7edal_, d7edam_, d7edao_, d7edat_, d7edau_
    automated match to d4il6x_
    complexed with bcr, bct, cla, dgd, fe2, hec, hem, lhg, lmg, oex, pho, pl9, rrx, sqd, unl

Details for d7edax_

PDB Entry: 7eda (more details), 2.78 Å

PDB Description: structure of monomeric photosystem ii
PDB Compounds: (X:) Photosystem II reaction center protein X

SCOPe Domain Sequences for d7edax_:

Sequence; same for both SEQRES and ATOM records: (download)

>d7edax_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr

SCOPe Domain Coordinates for d7edax_:

Click to download the PDB-style file with coordinates for d7edax_.
(The format of our PDB-style files is described here.)

Timeline for d7edax_:

  • d7edax_ is new in SCOPe 2.08-stable