Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.4: Transmembrane beta-barrels [56924] (7 superfamilies) not a true fold, gathers together transmembrane barrels of different (n,S) annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.4.1: OMPA-like [56925] (5 families) forms (8,10) barrel |
Family f.4.1.4: PsbO-like [161115] (2 proteins) Pfam PF01716; MSP |
Protein Manganese-stabilising protein, PsbO [161116] (2 species) |
Species Thermosynechococcus vulcanus [TaxId:32053] [189919] (28 PDB entries) |
Domain d3wu2o_: 3wu2 O: [259631] Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_ automated match to d4il6o_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl |
PDB Entry: 3wu2 (more details), 1.9 Å
SCOPe Domain Sequences for d3wu2o_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wu2o_ f.4.1.4 (O:) Manganese-stabilising protein, PsbO {Thermosynechococcus vulcanus [TaxId: 32053]} qtltyddivgtglankcptlddtargaypidssqtyriarlclqpttflvkeepknkrqe aefvptklvtrettsldqiqgelkvnsdgsltfveedgidfqpvtvqmaggeripllftv knlvastqpnvtsittstdfkgefnvpsyrtanfldpkgrglasgydsaialpqakeeel aranvkrfsltkgqislnvakvdgrtgeiagtfeseqlsdddmgahephevkiqgvfyas iepa
Timeline for d3wu2o_: