| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.40: Photosystem II reaction center protein X, PsbX [267599] (1 family) ![]() Pfam PF06596 |
| Family f.23.40.1: PsbX-like [267615] (2 proteins) |
| Protein automated matches [267680] (2 species) not a true protein |
| Species Thermosynechococcus vulcanus [TaxId:32053] [267915] (27 PDB entries) |
| Domain d3wu2x_: 3wu2 X: [262471] Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2k_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2z_ automated match to d3a0hx_ complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl |
PDB Entry: 3wu2 (more details), 1.9 Å
SCOPe Domain Sequences for d3wu2x_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3wu2x_ f.23.40.1 (X:) automated matches {Thermosynechococcus vulcanus [TaxId: 32053]}
titpslkgffigllsgavvlgltfavliaisqidkvqr
Timeline for d3wu2x_: