Lineage for d3wu2k_ (3wu2 K:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026646Superfamily f.23.36: Photosystem II reaction center protein K, PsbK [161037] (2 families) (S)
    automatically mapped to Pfam PF02533
  5. 3026647Family f.23.36.1: PsbK-like [161038] (2 proteins)
    Pfam PF02533
  6. 3026648Protein Photosystem II reaction center protein K, PsbK [161039] (2 species)
  7. 3026655Species Thermosynechococcus vulcanus [TaxId:32053] [192450] (26 PDB entries)
  8. 3026658Domain d3wu2k_: 3wu2 K: [259624]
    Other proteins in same PDB: d3wu2a_, d3wu2b_, d3wu2c_, d3wu2d_, d3wu2e_, d3wu2f_, d3wu2h_, d3wu2i_, d3wu2j_, d3wu2l_, d3wu2m_, d3wu2o_, d3wu2t_, d3wu2u_, d3wu2v_, d3wu2x_, d3wu2z_
    automated match to d2axtk1
    complexed with bcr, bct, ca, cl, cla, dgd, fe2, gol, hem, htg, lhg, lmg, lmt, mg, oex, pho, pl9, rrx, so4, sqd, unl

Details for d3wu2k_

PDB Entry: 3wu2 (more details), 1.9 Å

PDB Description: crystal structure analysis of photosystem ii complex
PDB Compounds: (K:) Photosystem II reaction center protein K

SCOPe Domain Sequences for d3wu2k_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3wu2k_ f.23.36.1 (K:) Photosystem II reaction center protein K, PsbK {Thermosynechococcus vulcanus [TaxId: 32053]}
klpeayaifdplvdvlpvipvlflalafvwqaavgfr

SCOPe Domain Coordinates for d3wu2k_:

Click to download the PDB-style file with coordinates for d3wu2k_.
(The format of our PDB-style files is described here.)

Timeline for d3wu2k_: