Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) automatically mapped to Pfam PF00223 |
Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
Protein automated matches [236561] (10 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276242] (9 PDB entries) |
Domain d6zxsb_: 6zxs B: [417453] Other proteins in same PDB: d6zxs1_, d6zxs2_, d6zxs3_, d6zxs4_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsj_, d6zxsl_ automated match to d6trab_ complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 6zxs (more details), 3 Å
SCOPe Domain Sequences for d6zxsb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zxsb_ f.29.1.1 (B:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} alrfprfsqglaqdpttrriwfgiatahdfeshdditegrlyqnifashfgqlaiiflwt sgnlfhvawqgnfeawvqdplhvrpiahaiwdphfgqpaveaftrggalgpvniaysgvy qwwytiglrtnedlytgaifllflsfisllagwlhlqpkwkpsvswfknaesrlnhhlsg lfgvsslawaghlvhvaipgsrgeyvrwnnflsvlphpqglgplftgqwnlyaqnpdssn hlfstsqgagtailtllggfhpqtqslwltdmahhhlaiailfligghmyrtnfgighsi kyileahippggrlgrghkglydtinnsihfqlglalaslgvitslvaqhmyslpayafi aqdfttqaalythhqyiagfimtgafahgaiffirdynpeqnadnvlarmlehkeaiish lswaslflgfhtlglyvhndvmlafgtpekqiliepifaqwiqsahgktsygfdvllsst nspalnagrsiwlpgwlnainensnslfltigpgdflvhhaialglhtttlilvkgalda rgsklmpdkkdfgysfpcdgpgrggtcdisawdafylavfwmlntigwvtfywhwkhitl wqgnvsqfnesstylmgwlrdylwlnssqlingynpfgmnslsvwawmflfghlvwatgf mfliswrgywqelietlawahertplanlirwrdkpvalsivqarlvglvhfsvgyifty aafliastsgkfg
Timeline for d6zxsb_: