Lineage for d6zxs4_ (6zxs 4:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3028373Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily)
    membrane all-alpha fold; three transmembrane helices
  4. 3028374Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) (S)
    duplication: contains two structural repeats
  5. 3028425Family f.43.1.0: automated matches [276197] (1 protein)
    not a true family
  6. 3028426Protein automated matches [276200] (4 species)
    not a true protein
  7. 3028483Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries)
  8. 3028511Domain d6zxs4_: 6zxs 4: [417451]
    Other proteins in same PDB: d6zxsa_, d6zxsb_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsj_, d6zxsl_
    automated match to d6yac4_
    complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d6zxs4_

PDB Entry: 6zxs (more details), 3 Å

PDB Description: cold grown pea photosystem i
PDB Compounds: (4:) chlorophyll a-b binding protein p4, chloroplastic

SCOPe Domain Sequences for d6zxs4_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zxs4_ f.43.1.0 (4:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
kkgewlpglaspgyltgslpgdngfdplglaedpenlkwfvqaelvngrwamlgvagmll
pevftsigiinvpkwydagkeeyfassstlfviefilfhyveirrwqdiknpgsvnqdpi
fkqyslpagevgypggifnplnfaptleakekeiangrlamlaflgfiiqhnvtgkgpfd
nllqhisdpwhntivqtl

SCOPe Domain Coordinates for d6zxs4_:

Click to download the PDB-style file with coordinates for d6zxs4_.
(The format of our PDB-style files is described here.)

Timeline for d6zxs4_:

  • d6zxs4_ is new in SCOPe 2.08-stable