| Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
| Fold f.23: Single transmembrane helix [81407] (42 superfamilies) not a true fold annotated by the SCOP(e) curators as 'not a true fold' |
Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) ![]() automatically mapped to Pfam PF01701 |
| Family f.23.18.0: automated matches [276196] (1 protein) not a true family |
| Protein automated matches [276198] (5 species) not a true protein |
| Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries) |
| Domain d6zxsj_: 6zxs J: [417459] Other proteins in same PDB: d6zxs1_, d6zxs2_, d6zxs3_, d6zxs4_, d6zxsa_, d6zxsb_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsl_ automated match to d6yacj_ complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 6zxs (more details), 3 Å
SCOPe Domain Sequences for d6zxsj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zxsj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltfpff
Timeline for d6zxsj_: