Lineage for d6zxsj_ (6zxs J:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3024792Fold f.23: Single transmembrane helix [81407] (42 superfamilies)
    not a true fold
    annotated by the SCOP(e) curators as 'not a true fold'
  4. 3026183Superfamily f.23.18: Subunit IX of photosystem I reaction centre, PsaJ [81544] (2 families) (S)
    automatically mapped to Pfam PF01701
  5. 3026208Family f.23.18.0: automated matches [276196] (1 protein)
    not a true family
  6. 3026209Protein automated matches [276198] (5 species)
    not a true protein
  7. 3026223Species Pea (Pisum sativum) [TaxId:3888] [276201] (9 PDB entries)
  8. 3026229Domain d6zxsj_: 6zxs J: [417459]
    Other proteins in same PDB: d6zxs1_, d6zxs2_, d6zxs3_, d6zxs4_, d6zxsa_, d6zxsb_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsl_
    automated match to d6yacj_
    complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex

Details for d6zxsj_

PDB Entry: 6zxs (more details), 3 Å

PDB Description: cold grown pea photosystem i
PDB Compounds: (J:) Photosystem I reaction center subunit IX

SCOPe Domain Sequences for d6zxsj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6zxsj_ f.23.18.0 (J:) automated matches {Pea (Pisum sativum) [TaxId: 3888]}
mrdlktylsvapvastlwfaalagllieinrffpdaltfpff

SCOPe Domain Coordinates for d6zxsj_:

Click to download the PDB-style file with coordinates for d6zxsj_.
(The format of our PDB-style files is described here.)

Timeline for d6zxsj_:

  • d6zxsj_ is new in SCOPe 2.08-stable