Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) duplication: contains two structural repeats |
Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
Protein automated matches [276200] (4 species) not a true protein |
Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries) |
Domain d6zxs1_: 6zxs 1: [417448] Other proteins in same PDB: d6zxsa_, d6zxsb_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsj_, d6zxsl_ automated match to d7dkz1_ complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 6zxs (more details), 3 Å
SCOPe Domain Sequences for d6zxs1_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zxs1_ f.43.1.0 (1:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} dwmpgqprpsyldgsapgdfgfdplrlgevpenlerfkeselihcrwamlavpgilvpea lglgnwvkaqewaalpggqatylgnpvpwgtlptilvieflsiafvehqrsmekdpekkk ypggafdplgyskdpkkfheykikevkngrlallafvgicvqqsaypgtgplenlathla dpwhntignvlip
Timeline for d6zxs1_: