![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.29: Photosystem I subunits PsaA/PsaB [81559] (1 superfamily) core:11 transmembrane helices |
![]() | Superfamily f.29.1: Photosystem I subunits PsaA/PsaB [81558] (2 families) ![]() automatically mapped to Pfam PF00223 |
![]() | Family f.29.1.1: Photosystem I subunits PsaA/PsaB [81557] (3 proteins) Photosystem I p700 chlorophyll a apoprotein a1/a2 |
![]() | Protein automated matches [236561] (10 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276242] (9 PDB entries) |
![]() | Domain d6zxsa_: 6zxs A: [417452] Other proteins in same PDB: d6zxs1_, d6zxs2_, d6zxs3_, d6zxs4_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsj_, d6zxsl_ automated match to d6traa_ complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 6zxs (more details), 3 Å
SCOPe Domain Sequences for d6zxsa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zxsa_ f.29.1.1 (A:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} pevkilvdrdpiktsfeqwakpghfsrtiakgpdtttwiwnlhadahdfdshtsdleeis rkvfsahfgqlsiiflwlsgmyfhgarfsnyeawlndpthirpsaqvvwpivgqeilngd vgggfrgiqitsgffqiwrasgitselqlyctaigalvfaalmlfagwfhyhkaapklvw fqdvesmlnhhlagllglgslswaghqvhvslpinqflnagvdpkeiplphefilnrdll aqlypsfaegatpfftlnwskyadfltfrggldpltgglwltdiahhhlaiailfliagh myrtnwgighgikdileahkgpftgqghkglyeilttswhaqlsinlamlgsltiivahh myamppypylatdygtqlslfthhmwiggflivgaaahaaifmvrdydpttryndlldrv lrhrdaiishlnwvciflgfhsfglyihndtmsalgrpqdmfsdtaiqlqpvfaqwiqnt halapgttapgattstsltwgggdlvsvggkvallpiplgtadflvhhihaftihvtvli llkgvlfarssrlipdkanlgfrfpcdgpgrggtcqvsawdhvflglfwmynaisvvifh fswkmqsdvwgsindqgvvthitggnfaqssitingwlrdflwaqasqviqsygsslsay glfflgahfvwafslmflfsgrgywqeliesivwahnklkvapatqpralsivqgravgv thyllggiattwafflariiavg
Timeline for d6zxsa_: