![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.43: Chlorophyll a-b binding protein [103510] (1 superfamily) membrane all-alpha fold; three transmembrane helices |
![]() | Superfamily f.43.1: Chlorophyll a-b binding protein [103511] (2 families) ![]() duplication: contains two structural repeats |
![]() | Family f.43.1.0: automated matches [276197] (1 protein) not a true family |
![]() | Protein automated matches [276200] (4 species) not a true protein |
![]() | Species Pea (Pisum sativum) [TaxId:3888] [276203] (10 PDB entries) |
![]() | Domain d6zxs3_: 6zxs 3: [417450] Other proteins in same PDB: d6zxsa_, d6zxsb_, d6zxsc_, d6zxsd_, d6zxse1, d6zxse2, d6zxsf_, d6zxsj_, d6zxsl_ automated match to d6yac3_ complexed with bcr, ca, chl, cl0, cla, dgd, gol, lhg, lmg, lmt, lut, pqn, sf4, xat, zex |
PDB Entry: 6zxs (more details), 3 Å
SCOPe Domain Sequences for d6zxs3_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6zxs3_ f.43.1.0 (3:) automated matches {Pea (Pisum sativum) [TaxId: 3888]} rplwfaskqslsyldgslpgdygfdplglsdpegtggfieprwlaygevingrfamlgav gaiapeylgkvglipqetalawfqtgvippagtynywadnytlfvlemalmgfaehrrfq dwakpgsmgkqyflglekgfggsgnpaypggpffnplgfgkdekslkelklkevkngrla mlailgyfiqglvtgvgpyqnlldhvadpvnnnvltslkfh
Timeline for d6zxs3_: