Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.140: Ribosomal protein S8 [56046] (1 superfamily) |
Superfamily d.140.1: Ribosomal protein S8 [56047] (1 family) |
Family d.140.1.1: Ribosomal protein S8 [56048] (1 protein) |
Protein Ribosomal protein S8 [56049] (3 species) |
Species Thermus thermophilus [TaxId:274] [56051] (11 PDB entries) |
Domain d1fjfh_: 1fjf H: [41467] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfh_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfh_ d.140.1.1 (H:) Ribosomal protein S8 {Thermus thermophilus} mltdpiadmltrirnatrvykestdvpasrfkeeilrilaregfikgyervdvdgkpylr vylkygprrqgpdprpeqvihhirriskpgrrvyvgvkeiprvrrglgiailstskgvlt drearklgvggelicevw
Timeline for d1fjfh_: