| Class c: Alpha and beta proteins (a/b) [51349] (107 folds) |
| Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) |
Superfamily c.55.4: Translational machinery components [53137] (2 families) ![]() |
| Family c.55.4.1: Ribosomal protein L18 and S11 [53138] (2 proteins) |
| Protein Ribosomal protein S11 [53141] (1 species) |
| Species Thermus thermophilus [TaxId:274] [53142] (10 PDB entries) |
| Domain d1fjfk_: 1fjf K: [33732] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfk_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfk_ c.55.4.1 (K:) Ribosomal protein S11 {Thermus thermophilus}
krqvasgrayihasynntivtitdpdgnpitwssggvigykgsrkgtpyaaqlaaldaak
kamaygmqsvdvivrgtgagreqairalqasglqvksivddtpvphngcrpkkkfrkas
Timeline for d1fjfk_: