![]() | Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
![]() | Superfamily d.58.14: Ribosomal protein S6 [54995] (1 family) ![]() |
![]() | Family d.58.14.1: Ribosomal protein S6 [54996] (1 protein) |
![]() | Protein Ribosomal protein S6 [54997] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [54998] (16 PDB entries) |
![]() | Domain d1fjff_: 1fjf F: [39315] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjff_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjff_ d.58.14.1 (F:) Ribosomal protein S6 {Thermus thermophilus} mrryevnivlnpnldqsqlalekeiiqralenygarvekveelglrrlaypiakdpqgyf lwyqvempedrvndlarelrirdnvrrvmvvksqepflana
Timeline for d1fjff_: