Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily) |
Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) |
Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein) |
Protein Ribosomal protein S3 C-terminal domain [54823] (1 species) |
Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries) |
Domain d1fjfc2: 1fjf C:107-207 [38838] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus} qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte waaqgrvplhtlranidygfalarttygvlgvkayiflgev
Timeline for d1fjfc2: