Lineage for d1fjfc2 (1fjf C:107-207)

  1. Root: SCOP 1.57
  2. 75819Class d: Alpha and beta proteins (a+b) [53931] (194 folds)
  3. 79847Fold d.53: Ribosomal protein S3 C-terminal domain [54820] (1 superfamily)
  4. 79848Superfamily d.53.1: Ribosomal protein S3 C-terminal domain [54821] (1 family) (S)
  5. 79849Family d.53.1.1: Ribosomal protein S3 C-terminal domain [54822] (1 protein)
  6. 79850Protein Ribosomal protein S3 C-terminal domain [54823] (1 species)
  7. 79851Species Thermus thermophilus [TaxId:274] [54824] (10 PDB entries)
  8. 79852Domain d1fjfc2: 1fjf C:107-207 [38838]
    Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_

Details for d1fjfc2

PDB Entry: 1fjf (more details), 3.05 Å

PDB Description: structure of the thermus thermophilus 30s ribosomal subunit

SCOP Domain Sequences for d1fjfc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjfc2 d.53.1.1 (C:107-207) Ribosomal protein S3 C-terminal domain {Thermus thermophilus}
qnpnlsaplvaqrvaeqierrfavrraikqavqrvmesgakgakvivsgriggaeqarte
waaqgrvplhtlranidygfalarttygvlgvkayiflgev

SCOP Domain Coordinates for d1fjfc2:

Click to download the PDB-style file with coordinates for d1fjfc2.
(The format of our PDB-style files is described here.)

Timeline for d1fjfc2: