| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.66: Alpha-L RNA-binding motif [55173] (1 superfamily) |
Superfamily d.66.1: Alpha-L RNA-binding motif [55174] (3 families) ![]() |
| Family d.66.1.2: Ribosomal protein S4 [55178] (1 protein) |
| Protein Ribosomal protein S4 [55179] (2 species) |
| Species Thermus thermophilus [TaxId:274] [55180] (10 PDB entries) |
| Domain d1fjfd_: 1fjf D: [39552] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfj_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfd_ d.66.1.2 (D:) Ribosomal protein S4 {Thermus thermophilus}
gryigpvcrlcrregvklylkgercyspkcamerrpyppgqhgqkrarrpsdyavrlrek
qklrriygiserqfrnlfeeaskkkgvtgsvflgllesrldnvvyrlgfavsrrqarqlv
rhghitvngrrvdlpsyrvrpgdeiavaeksrnlelirqnleamkgrkvgpwlsldvegm
kgkflrlpdredlalpvqenlviefysr
Timeline for d1fjfd_: