| Class d: Alpha and beta proteins (a+b) [53931] (194 folds) |
| Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.15: Ribosomal protein S10 [54999] (1 family) ![]() |
| Family d.58.15.1: Ribosomal protein S10 [55000] (1 protein) |
| Protein Ribosomal protein S10 [55001] (1 species) |
| Species Thermus thermophilus [TaxId:274] [55002] (10 PDB entries) |
| Domain d1fjfj_: 1fjf J: [39329] Other proteins in same PDB: d1fjfb_, d1fjfc1, d1fjfc2, d1fjfd_, d1fjfe1, d1fjfe2, d1fjff_, d1fjfg_, d1fjfh_, d1fjfi_, d1fjfk_, d1fjfl_, d1fjfm_, d1fjfn_, d1fjfo_, d1fjfp_, d1fjfq_, d1fjfr_, d1fjfs_, d1fjft_, d1fjfv_ |
PDB Entry: 1fjf (more details), 3.05 Å
SCOP Domain Sequences for d1fjfj_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fjfj_ d.58.15.1 (J:) Ribosomal protein S10 {Thermus thermophilus}
kiriklrgfdhktldasaqkiveaarrsgaqvsgpiplptrvrrftvirgpfkhkdsreh
felrthnrlvdiinpnrktieqlmtldlptgveieikt
Timeline for d1fjfj_: